DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYTB and petB

DIOPT Version :9

Sequence 1:YP_009047277.1 Gene:CYTB / 19893556 FlyBaseID:FBgn0013678 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_051088.1 Gene:petB / 844729 -ID:- Length:215 Species:Arabidopsis thaliana


Alignment Length:193 Identity:64/193 - (33%)
Similarity:106/193 - (54%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHICRDVNYGWLLRTLHAN 86
            :|..:||  ::..|.:...|.::|:.||..:..:|...:..||.||.:|..:.|:|||:|::|..
plant    26 VPPHVNI--FYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRW 88

  Fly    87 GASFFFICIYLHVGRGIYYGSYKFTP---TWLIGVIILFLVMGTAFMGYVLPWGQMSFWGATVIT 148
            .||...:.:.|||.|....|.:| .|   ||:.||::..|.......||.|||.|:.:|...::|
plant    89 SASMMVLMMILHVFRVYLTGGFK-KPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVT 152

  Fly   149 NLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFH-FILPFIVLAMTMIHLLFLHQTGSNNPI 210
            .:..|||.:|..||:.|.|..:|..:|||||::.| |:||.:.....::|.|.:.:.|.:.|:
plant   153 GVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYTBYP_009047277.1 CYTB 12..367 CDD:214440 64/193 (33%)
petBNP_051088.1 petB 1..215 CDD:177009 63/191 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1125966at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.