DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND3 and ND3

DIOPT Version :10

Sequence 1:YP_009047272.1 Gene:ND3 / 19893542 FlyBaseID:FBgn0013681 Length:117 Species:Drosophila melanogaster
Sequence 2:YP_003024033.1 Gene:ND3 / 4537 HGNCID:7458 Length:115 Species:Homo sapiens


Alignment Length:110 Identity:47/110 - (42%)
Similarity:78/110 - (70%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILLITTIVMFLASILS---KKALIDREKSSPFECGFDPKSSSRLPFSLRFFLITIIFLIFDVEI 71
            |||:|.|::..|..|::   .:.....|||:|:||||||.|.:|:|||::|||:.|.||:||:||
Human     5 LILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEI 69

  Fly    72 ALILPMIIIMKYSNIMIWTITSIIFILILLIGLYHEWNQGMLNWS 116
            ||:||:...::.:|:.:..::|::.|:||.:.|.:||.|..|:|:
Human    70 ALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWT 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND3YP_009047272.1 ND3 18..115 CDD:177217 41/99 (41%)
ND3YP_003024033.1 ND3 1..115 CDD:177168 47/110 (43%)

Return to query results.
Submit another query.