DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6 and AT2G07741

DIOPT Version :9

Sequence 1:YP_009047270.1 Gene:ATP6 / 19893539 FlyBaseID:FBgn0013672 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_178810.1 Gene:AT2G07741 / 815413 AraportID:AT2G07741 Length:385 Species:Arabidopsis thaliana


Alignment Length:253 Identity:80/253 - (31%)
Similarity:117/253 - (46%) Gaps:62/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FSVFDPSAIFNFSLNWLSTFLGLL----------MIPSIYWLMPSRYNIMWNSI-------LLTL 53
            ||..:||.   |.|..||.||.|:          ::|:           .|.|:       :|.|
plant   154 FSFTNPSL---FMLLTLSFFLLLIHFVTKKGGGNLVPN-----------AWQSLVELLYDFVLNL 204

  Fly    54 HKEFKTLLGPSGHNGSTFI--FISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLY 116
            .||  .:.|.||:....|.  .:..|..:||.|..|:.||.||.|||..:||:|:..:::...:.
plant   205 VKE--QIGGLSGNVKQMFFPCILVTFLFLLFCNLQGMIPYSFTVTSHFLITLALSFSIFIGITIV 267

  Fly   117 GWINHTQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLL------ 175
            |:..|..|.|:.|:|.|.|..|.||:|.:|.||...|..:|.:||.|||:|||.|:.:|      
plant   268 GFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRALSLGIRLFANMMAGHSLVKILSGFAWT 332

  Fly   176 -----------GNTGPSMSYILVTFLLMAQIALLVLESAVAMIQSYVFAVLSTLYSSE 222
                       |..||          |...:||..||..||::|:|||.:|..:|.::
plant   333 MLCMNDIFYFIGALGP----------LFIVLALTGLELGVAILQAYVFTILICIYLND 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6YP_009047270.1 ATP6 1..224 CDD:214441 80/253 (32%)
AT2G07741NP_178810.1 ATP_synt_6_or_A 135..382 CDD:273458 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2288
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2134
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095315at2759
OrthoFinder 1 1.000 - - FOG0002431
OrthoInspector 1 1.000 - - otm3184
orthoMCL 1 0.900 - - OOG6_102362
Panther 1 1.100 - - LDO PTHR11410
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.