DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6 and ATP6

DIOPT Version :9

Sequence 1:YP_009047270.1 Gene:ATP6 / 19893539 FlyBaseID:FBgn0013672 Length:224 Species:Drosophila melanogaster
Sequence 2:YP_003024031.1 Gene:ATP6 / 4508 HGNCID:7414 Length:226 Species:Homo sapiens


Alignment Length:227 Identity:87/227 - (38%)
Similarity:131/227 - (57%) Gaps:14/227 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMTNLFSVFDPSAIFNFSLNWLSTFLGLLMIPSIYWLMPSRYNIMWNSILLTLHKEFKTLLGPSG 65
            |..|||:.|....|.......|......|:||:..:|:.:|.......::....|:..|:....|
Human     1 MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKG 65

  Fly    66 HNGSTFIFISLFSLILF---NNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWINHTQHMFA 127
            ...|    :.|.|||:|   .|.:||.|:.||.|:.|::.|::|:|||...::.|:.:..::..|
Human    66 RTWS----LMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALA 126

  Fly   128 HLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGPSMSYI-----LV 187
            |.:|||||..|:|.:|.|||||.:|:|..||||||||:.|||||:.|:|:...:||.|     |:
Human   127 HFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLI 191

  Fly   188 TFLLMAQIALLVLESAVAMIQSYVFAVLSTLY 219
            .|.::  |.|.:||.|||:||:|||.:|.:||
Human   192 IFTIL--ILLTILEIAVALIQAYVFTLLVSLY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6YP_009047270.1 ATP6 1..224 CDD:214441 87/227 (38%)
ATP6YP_003024031.1 ATP6 1..226 CDD:177163 87/227 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143766
Domainoid 1 1.000 135 1.000 Domainoid score I4999
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4522
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55185
OrthoDB 1 1.010 - - D1095315at2759
OrthoFinder 1 1.000 - - FOG0002431
OrthoInspector 1 1.000 - - oto90018
orthoMCL 1 0.900 - - OOG6_102362
Panther 1 1.100 - - LDO PTHR11410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R115
SonicParanoid 1 1.000 - - X4129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.