DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6 and ATP6

DIOPT Version :9

Sequence 1:YP_009047270.1 Gene:ATP6 / 19893539 FlyBaseID:FBgn0013672 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_006956.1 Gene:ATP6 / 2565704 -ID: Length:199 Species:Caenorhabditis elegans


Alignment Length:211 Identity:59/211 - (27%)
Similarity:97/211 - (45%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WLSTFLGLLMIPSIYWLMPSRYNIMWNSILLTLHKEF-KTLLGPSGHNG----STFIFISLFSLI 80
            :|..|:.:.::..:::...|..|        ||.|:| .:|:|...:..    |:.|.|..|.::
 Worm     6 FLDIFMFVFVLQFLFYFKESMLN--------TLVKKFLNSLVGVFSYTNTLPLSSVISIFTFIVL 62

  Fly    81 LFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWINHTQHMFAHLVPQGTPAILMPFMVCI 145
            |...|.|.|.|.|.....:..|...|...||..:| .:|: ::....::...|...:....|:.|
 Worm    63 LTCCFGGYFTYSFCPCGMVEFTFVYAAVAWLSTLL-TFIS-SEKFSVYMSKPGDTYLKTLSMLLI 125

  Fly   146 ETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGPSMS----YILVTFLLMAQIALLVLESAVAM 206
            |.:|...||..|.||||.|:..|||:..:| ..|..:|    ||.::.|      .:::|..|..
 Worm   126 EIVSEFSRPLALTVRLTVNITVGHLVSMML-YQGLELSMGDQYIWLSIL------AIMMECFVFF 183

  Fly   207 IQSYVFAVLSTLYSSE 222
            ||||:|:.|..||.:|
 Worm   184 IQSYIFSRLIFLYLNE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6YP_009047270.1 ATP6 1..224 CDD:214441 59/211 (28%)
ATP6NP_006956.1 ATP6 1..199 CDD:177152 55/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I7366
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I4037
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095315at2759
OrthoFinder 1 1.000 - - FOG0002431
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102362
Panther 1 1.100 - - LDO PTHR11410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R115
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.