DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6 and ATP6

DIOPT Version :9

Sequence 1:YP_009047270.1 Gene:ATP6 / 19893539 FlyBaseID:FBgn0013672 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_904333.1 Gene:ATP6 / 17705 MGIID:99927 Length:226 Species:Mus musculus


Alignment Length:233 Identity:86/233 - (36%)
Similarity:130/233 - (55%) Gaps:26/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMTNLFSVFDPSAIFNFSLNWLSTFLGLLMIPSIYWLMPSRYNIMWNSILLTLH-------KEFK 58
            |..|||:.|....:..|.:     .:.::|.|||  |.||...::.|.:....|       |:..
Mouse     1 MNENLFASFITPTMMGFPI-----VVAIIMFPSI--LFPSSKRLINNRLHSFQHWLVKLIIKQMM 58

  Fly    59 TLLGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWINHTQ 123
            .:..|.|... |.:.:||...|...|.:||.|:.||.|:.|::.||:|:|||...::.|:.:..:
Mouse    59 LIHTPKGRTW-TLMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVITGFRHKLK 122

  Fly   124 HMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLG-------NTGPS 181
            ...||.:|||||..|:|.::.|||||..|:|..||||||||:.|||||:.|:|       |..|.
Mouse   123 SSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMNISPP 187

  Fly   182 MSYILVTFLLMAQIALLVLESAVAMIQSYVFAVLSTLY 219
            .:  .:||:::  :.|.:||.|||:||:|||.:|.:||
Mouse   188 TA--TITFIIL--LLLTILEFAVALIQAYVFTLLVSLY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6YP_009047270.1 ATP6 1..224 CDD:214441 86/233 (37%)
ATP6NP_904333.1 ATP6 1..226 CDD:177163 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833994
Domainoid 1 1.000 129 1.000 Domainoid score I5256
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4569
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55185
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002431
OrthoInspector 1 1.000 - - oto93595
orthoMCL 1 0.900 - - OOG6_102362
Panther 1 1.100 - - LDO PTHR11410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R115
SonicParanoid 1 1.000 - - X4129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.