DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6 and ScpofMp06

DIOPT Version :9

Sequence 1:YP_009047270.1 Gene:ATP6 / 19893539 FlyBaseID:FBgn0013672 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_039504.1 Gene:ScpofMp06 / 1669530 -ID:- Length:257 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:78/247 - (31%)
Similarity:128/247 - (51%) Gaps:44/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MTNLFSVFDPSAIFNFSLNW--LSTFLGLLMIPSIYW-------------LMPSRYNIMWNSILL 51
            :.|.|..:    :||:..::  ...:|||..:.:|..             ::|.::.|...:|..
pombe    12 LNNYFGFY----LFNYHFDFSNFGFYLGLSALIAISLAIINLTPYGSGAKIVPQKFGIAMEAIYF 72

  Fly    52 T--------LHKEFKTLLGPSGHNGSTFIFI-SLFSLILFNNFMGLFPYIFTSTSHLTLTLSLAL 107
            |        :|.. ||:.|.     |.|.|| |||.||||:|.:.|.||.:.:|:.|..||.|::
pombe    73 TMLNLVENQIHSS-KTVSGQ-----SYFPFIWSLFVLILFSNLLRLIPYGYATTAQLIFTLGLSI 131

  Fly   108 PLWLCFMLYGWINHTQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLL 172
            .:.:...:.|...|...:|...:|.|||..|:|.:|.||.:|.|.|..:|.:||.||:|||||.:
pombe   132 SILIGATILGLQQHKAKVFGLFLPSGTPTPLIPLLVLIEFVSYIARGLSLGIRLGANIIAGHLTM 196

  Fly   173 TLLGNTGPSMSYI---LVTFL-----LMAQIALLVLESAVAMIQSYVFAVLS 216
            ::||  |...:::   |:||:     :...:|:.:||..:|.||:||||:|:
pombe   197 SILG--GLIFTFMGLNLITFIIGFLPITVLVAISLLEFGIAFIQAYVFAILT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6YP_009047270.1 ATP6 1..224 CDD:214441 78/247 (32%)
ScpofMp06NP_039504.1 ATP_synt_6_or_A 28..254 CDD:273458 74/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I1682
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I1607
OMA 1 1.010 - - QHG55185
OrthoFinder 1 1.000 - - FOG0002431
OrthoInspector 1 1.000 - - oto101272
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R115
SonicParanoid 1 1.000 - - X4129
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.