DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6 and ATP6

DIOPT Version :9

Sequence 1:YP_009047270.1 Gene:ATP6 / 19893539 FlyBaseID:FBgn0013672 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_059336.1 Gene:ATP6 / 140519 ZFINID:ZDB-GENE-011205-18 Length:227 Species:Danio rerio


Alignment Length:240 Identity:87/240 - (36%)
Similarity:124/240 - (51%) Gaps:33/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMTNLFSVFDPSAIFNFSLNWLSTFLGLLMIPSIYWLMPSRYNIMW-NSILLTLH--------KE 56
            |||:.|..|....:....|     .|..:::|   ||:.......| |:.|:|:.        .:
Zfish     1 MMTSFFDQFASPYLLGIPL-----ILVAMLLP---WLLFPAPTSRWINNRLITVQTWLTGRFTNQ 57

  Fly    57 FKTLLGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWINH 121
            ..|.|..|||..: .:|.||...::..|.:||.||.||.|:.|:|.:..|:||||..::.|..|.
Zfish    58 LMTPLNFSGHKWA-LLFASLMVFLITINLLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMKNQ 121

  Fly   122 TQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGPSMSYIL 186
            ......||:|:|||..|:|.::.|||||..|||..|.||||||:.|||||:.|:...      :.
Zfish   122 PTIALGHLLPEGTPIPLIPALIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATA------VF 180

  Fly   187 VTFLLMAQIALL---------VLESAVAMIQSYVFAVLSTLYSSE 222
            |...:|..:|:|         :||.||||||:|||.:|.:||..|
Zfish   181 VLLPMMPAVAILTASVLFLLTLLEVAVAMIQAYVFILLLSLYLQE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6YP_009047270.1 ATP6 1..224 CDD:214441 87/240 (36%)
ATP6NP_059336.1 ATP6 1..227 CDD:177190 87/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576709
Domainoid 1 1.000 124 1.000 Domainoid score I5487
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4655
OMA 1 1.010 - - QHG55185
OrthoDB 1 1.010 - - D1095315at2759
OrthoFinder 1 1.000 - - FOG0002431
OrthoInspector 1 1.000 - - oto39160
orthoMCL 1 0.900 - - OOG6_102362
Panther 1 1.100 - - LDO PTHR11410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R115
SonicParanoid 1 1.000 - - X4129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.