DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rom1 and Tsp86D

DIOPT Version :9

Sequence 1:NP_033099.3 Gene:Rom1 / 19881 MGIID:97998 Length:351 Species:Mus musculus
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:344 Identity:76/344 - (22%)
Similarity:121/344 - (35%) Gaps:88/344 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 IWLLSWLLALVGGLTL----------LCSGHLLVQLGHLGTFLAPSCSFPALPQTALAAGTVALG 75
            |:||::|..|.|||.|          |..|:..::|..:...:.      .:....:.||.:...
  Fly    35 IFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIF------NISLVMIIAGVIVFT 93

Mouse    76 TGLGGAGASRASLDAAQYPPWRGVLTPLLAVGTAAGGGLLTLALGLALAL-----PVSLNQGLEE 135
            ....|.      |.|.:...|   |..|.::..     ||...|.::||:     |..:|..||.
  Fly    94 VSFAGC------LGALRENTW---LLKLYSMCL-----LLFFILEMSLAIICFVFPQYMNSFLEY 144

Mouse   136 GLEAALAH-YKDTEVPGRCQAKRLMDELQLRYHCCG--RHGYKDWFGVQWVSNRYLDPSDQDVVD 197
            .....:.| |:|..     ..:..:|..|..::|||  ..||:|     |..|.|.:.|... |:
  Fly   145 QFTDKIIHSYRDDS-----DLQNFIDFAQQEFNCCGLSNAGYQD-----WSKNEYFNCSSPS-VE 198

Mouse   198 RIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPYAHPLFDPRQPNLNLWAQGCHEVLLEHLQ 262
            |.           |||:|||...:........:...|...:......:..:|..||.|::...::
  Fly   199 RC-----------GVPYSCCINATDISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVE 252

Mouse   263 GLSGTLGSILAVTLLLQILVLLGLRYLQTALEGLGGVIDGEGEAQGYLFPGGLKDILKTAW--LQ 325
            .....:..:.....|||:.|:    ||...||                   |..|:.|:.|  :|
  Fly   253 RNLYVIAGVALGIALLQLFVI----YLAKTLE-------------------GQIDLQKSRWSXVQ 294

Mouse   326 GGLAHKPAPEEAPPDEEPP 344
               .|.|.....||.|:.|
  Fly   295 ---CHHPYLYGYPPCEDDP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rom1NP_033099.3 peripherin_like_LEL 128..264 CDD:239415 31/138 (22%)
Tetraspannin <129..274 CDD:278750 31/147 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..351 6/16 (38%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 57/296 (19%)
penumbra_like_LEL 132..255 CDD:239411 32/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.