DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc22a8 and CG33233

DIOPT Version :9

Sequence 1:NP_001158106.1 Gene:Slc22a8 / 19879 MGIID:1336187 Length:537 Species:Mus musculus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:289 Identity:71/289 - (24%)
Similarity:121/289 - (41%) Gaps:58/289 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    92 TEPCLDGWIYNSTRDTIVT--EWDLVCGSNKLKEMAQSVFMAGILVGGPVFGELSDRFGRKPILT 154
            ||....|::      .::|  |:|.   |.|.|.:..:..:.|::..|...|.|:||:|||.::.
  Fly    35 TESMTAGYL------VVLTSCEFDT---SPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIR 90

Mouse   155 WSYLLLAASGSSAAFSPSLTVYMIFRFLCGCSISGI-SLSTIILN----VEWVPTSTRAISSTTI 214
            .:.:...:....:|..|.|....:.|.:.|..:|.: ||....|.    ::|.|. |.||.|.:.
  Fly    91 LALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPI-TVAICSQSQ 154

Mouse   215 G----YCYTIGQFILP-------GLAYAVPQWRWLQLSVSAAFFIFSLLSWW--------VPESI 260
            |    ||..:...|||       ..:|.:..||:|.:        |.::..|        |||:.
  Fly   155 GLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMM--------FFMIPGWLALVGICLVPETP 211

Mouse   261 RWLVLSGKFSKALKTLQRVATFNGKKEEGEKLTVEELKFNLQKDITSAK------VKYGLSDLFR 319
            .:|:...:..|||..|:.:...|.||.|...:|:.|     :|..|:.:      |.|....||.
  Fly   212 HFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSE-----EKSSTNDQEGFWKTVWYEYKLLFS 271

Mouse   320 VSILRRVTFCLSLAWFATGFAYYSLAMGV 348
            ...:.:...||.|.:   |..:.|:.:|:
  Fly   272 KPHVFKFFICLFLIF---GIFFTSIGLGI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc22a8NP_001158106.1 2A0119 11..503 CDD:273328 71/289 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..537
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 71/289 (25%)
MFS 23..>208 CDD:119392 45/190 (24%)
MFS 354..>482 CDD:304372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.