DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a16 and CYP97A3

DIOPT Version :9

Sequence 1:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:523 Identity:130/523 - (24%)
Similarity:207/523 - (39%) Gaps:112/523 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPQLRPHFLFGHFFRLQSVHYSELLQETYDAFRGSAKVAGTYVFLRPMAVVLDLDLVKAVL---- 91
            ||.......:|..|||           |:          |...||    :|.|..:.|.:|    
plant   130 IPLYELFLTYGGIFRL-----------TF----------GPKSFL----IVSDPSIAKHILKDNA 169

  Fly    92 -------IRDFNNFVDRRSFHGDPLTANLFNLQGEEWRNLRTKLSPTFTSGKMKY------MFGT 143
                   :.:..:||         :...|....||.||..|..:.|..   ..||      :||.
plant   170 KAYSKGILAEILDFV---------MGKGLIPADGEIWRRRRRAIVPAL---HQKYVAAMISLFGE 222

  Fly   144 VS-TVAQQLGGTFDELVGSQGAVLELHDLMARYTTDVIGSCAFGTECSSLREPQAEFRQVGRRIF 207
            .| .:.|:|     :....:|..:|:..|.:|.|.|:||...|..:..||.........|...:.
plant   223 ASDRLCQKL-----DAAALKGEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVIEAVYTVLR 282

  Fly   208 RNSNRSIR----WRIFKMTYLS-SLAKLGLPVRILH---PDITKFFNRIVRETVELRERE---NI 261
            ...:||:.    |.|.....:| ...|:...:::::   .|:.....|:|.|. ||:..|   |.
plant   283 EAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKLINDTLDDLIATCKRMVEEE-ELQFHEEYMNE 346

  Fly   262 RRNDFMDLLLDLRRQENGKGLTMEQMAAQAFVFFVAGFETSSSNMSYALFELAKNQDVQQKLRME 326
            |....:..||     .:|..::.:|:........:||.|||::.:::..:.|.....|..||:.|
plant   347 RDPSILHFLL-----ASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEE 406

  Fly   327 INDSIGKHGKLTYEAMMEMPYLDQTITETLRKYPALSSLTRLASEDYEIPSPDGGDPVVLEKGTS 391
            ::..||.... |.:.|.::.|..:.:.|:||.||....|.| .|.|.:|.   |..|:  ::|..
plant   407 VDSVIGDRFP-TIQDMKKLKYTTRVMNESLRLYPQPPVLIR-RSIDNDIL---GEYPI--KRGED 464

  Fly   392 VHIPVLAIHYDPEVYPEPHEFRPERF---APDACRERHPTAFLGFGDGPRNCIGLRFGRMQVKVG 453
            :.|.|..:|..|..:.:..:|.|||:   .|:........::|.||.|||.|||..|...:..|.
plant   465 IFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVA 529

  Fly   454 LITLLRRFRFSLPPGSP---------------TQLKVTKR-------NLILLPSDGVRLQVDPVE 496
            :..|:|||.|.:.||:|               .:|.||||       ::.:||.|..|   |.|.
plant   530 IAMLIRRFNFQIAPGAPPVKMTTGATIHTTEGLKLTVTKRTKPLDIPSVPILPMDTSR---DEVS 591

  Fly   497 SRL 499
            |.|
plant   592 SAL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 125/513 (24%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 130/523 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.