DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a16 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:239 Identity:53/239 - (22%)
Similarity:95/239 - (39%) Gaps:63/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GTYVFLRPMAVVLDLDLVKAVLIRDFNNFVDRRSFHGDPLTANLFNLQGEEWRNLRTKLSPTFTS 134
            |.|    |..:|:|.:.::.::.:.......:...|.....:.|.|.:|.:|...|:.|:|.|..
plant   103 GPY----PNVIVMDPETLREIMSKHELFPKPKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRI 163

  Fly   135 GKMKYMFGTVSTVAQQLGGTFDELVGSQGAVLEL------HDLMARYTTDVIGSCAFGTECSSLR 193
            ..:|.:....::..:::...::.|..::| .:||      |||    |.:::...:||   .|.:
plant   164 DNLKSILPAFNSSCKEMLEEWERLASAKG-TMELDSWTHCHDL----TRNMLARASFG---DSYK 220

  Fly   194 EPQAEFRQVGRRIFRNSNRSIRWRIFKMTYLSSLAKLG-LPVRILHPDITKF----FNRIVRET- 252
            :        |.:||......|              .|| |.:|.::...:||    |||.:||| 
plant   221 D--------GIKIFEIQQEQI--------------DLGLLAIRAVYIPGSKFLPTKFNRRLRETE 263

  Fly   253 ----------VELRERENIRRNDFMDLLLD------LRRQENGK 280
                      :|.:| |.|:|....|...|      ||.|:..|
plant   264 RDMRAMFKAMIETKE-EEIKRGRGTDKNSDCCSRCWLRIQKPSK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 53/239 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.