DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a16 and CYP71A27

DIOPT Version :9

Sequence 1:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:474 Identity:108/474 - (22%)
Similarity:193/474 - (40%) Gaps:131/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLTSLLSFL-LGYLRYRFTY---------WEL---RGIPQLRP------HFLFGHFFRLQSVHY 51
            |.||:||:|| |..|..|.|.         |.|   ..:.||.|      |.|...:..|..:|:
plant     8 LCLTTLLAFLFLKPLLKRITTTKPKLPPSPWRLPVIGNLHQLGPNPHRYLHSLSLRYGPLMLLHF 72

  Fly    52 SEL-------------LQETYDAFRGSAKVAGTYVFLRPMAVVLDLDLVKAVLI-----RDFNNF 98
            ..:             :.:|:|     .|.|.     ||.:        ||:.|     ||.   
plant    73 GRVPVLVVSCPDVTNDIMKTHD-----LKFAN-----RPKS--------KAINIFMEGGRDI--- 116

  Fly    99 VDRRSFHGDPLTANLFNLQGEEWRNLRTKLSPTFTSGKMKYMFGT-----VSTVAQQLGGTFDEL 158
                          :|...||:|:::::.......:.||...|..     :..:.::|     |.
plant   117 --------------IFGPYGEDWKSMKSLGVVHLLNNKMVRSFENLREEEIKVMTEKL-----EE 162

  Fly   159 VGSQGAVLELHDLMARYTTDVIGSCAF-----------GTECSSLREPQAEFRQVGRRIFRNSNR 212
            ..|..:.:.|..|:...|.|:|  |..           |.:..:|....:||  .|:..|.:...
plant   163 ASSSSSSVNLSKLLMTLTNDII--CRITLGRKYNEEEGGIDIKNLVMTSSEF--FGKFFFGDFIP 223

  Fly   213 SIRWRIFKMTYLSSLAKLGLPVRILHPDITKFFNRIVRETVELRERENIRRNDFMDLLLDLRRQE 277
            |:.|    :.::|.:..   .::.::..:..|.:.:|:|.|:...:|   .:||:|:||.:::.:
plant   224 SLAW----IDWISGIDD---KMKDINNKLDCFLDSMVQEHVDADHKE---PSDFIDMLLLIQKDK 278

  Fly   278 NGKG--------LTMEQMAAQAFVFFVAGFETSSSNMSYALFELAKNQDVQQKLRMEINDSIGKH 334
            ..:.        |.::.|       |.:|..|::|.:.:.:.||.::.:..:||:.||| |...|
plant   279 TKRFKFDRSDLILILKDM-------FFSGTATTASQLEWTMTELMRHPECMKKLQDEIN-SFSTH 335

  Fly   335 G-KLTYEAMMEMPYLDQTITETLRKYPALSSLTRLASEDYEIPSPDGGDPVVLEKGTSVHIPVLA 398
            . .:|.:.:.:|.||...|.|.||.:|:...|.||.|||.::...|      :..||.|.|...|
plant   336 NLNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQLKGYD------ISAGTHVIINAWA 394

  Fly   399 IHYDPEVYP-EPHEFRPER 416
            :..:|.::. :.:|:||||
plant   395 LQRNPAIWGLDANEYRPER 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 95/435 (22%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 97/449 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.