DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a16 and CYP709B2

DIOPT Version :9

Sequence 1:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:521 Identity:134/521 - (25%)
Similarity:222/521 - (42%) Gaps:97/521 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RYRFTYWELRGI--------------------PQLRPHFLFGHFFRLQSVHYSELLQETYDAFRG 64
            :||..|..||.|                    |::.||        ||  .:.....||:..::|
plant   104 KYRILYGNLREIRKMKNEAKLMVLDPNSNDIVPRVLPH--------LQ--QWKSQYGETFLYWQG 158

  Fly    65 SAKVAGTYVFLRPMAVVLDLDLVKAVLIRDFNNFVDRRSFHGDP----LTAN-LFNLQGEEWRNL 124
            :          .|...:.|.:|.|.:|   .|.||........|    |:.| |..:.|.:|...
plant   159 T----------DPRLCISDHELAKQIL---SNKFVFFSKSKTKPEILKLSGNGLIFVNGLDWVRH 210

  Fly   125 RTKLSPTFTSGKMKYM--------FGTVSTVAQQLGGTFDELVGSQGAVLELHDLMARYTTDVIG 181
            |..|:|.|:..|:|.|        |.......:|..|     |.::..||...: ..|.|.|:|.
plant   211 RRILNPAFSMDKLKLMTQLMVDCTFRMFLEWKKQRNG-----VETEQFVLISRE-FKRLTADIIA 269

  Fly   182 SCAFGTECSSLREPQAEFRQVGRRIFRNSNRSIRWRIFKMT--YLSSLAKLGLPVRI----LHPD 240
            :.|||   ||..|        |..:|::.....:.....:|  |...:..|..|..:    |...
plant   270 TAAFG---SSYAE--------GIEVFKSQLELQKCCAAALTDLYFPGIQYLPTPSNLQIWKLDMK 323

  Fly   241 ITKFFNRIV--RETVELRERENIRRNDFMDLLLD-LRRQENGKGLTMEQMAAQAFVFFVAGFETS 302
            :.....||:  |.|.|.::    ..||.:.::|. ....|:.|.::::::..:...||.||.||:
plant   324 VNSSIKRIIDARLTSESKD----YGNDLLGIMLTAASSNESEKKMSIDEIIEECKTFFFAGHETT 384

  Fly   303 SSNMSYALFELAKNQDVQQKLRMEINDSIGKHGKLTYEAMMEMPYLDQTITETLRKYPALSSLTR 367
            ::.::::...|:.:||.|:|||.|:.:..||......|...::..::....|:||.|..:.:|.|
plant   385 ANLLTWSTMLLSLHQDWQEKLREEVFNECGKDKIPDAETCSKLKLMNTVFMESLRLYGPVLNLLR 449

  Fly   368 LASEDYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVY-PEPHEFRPERFAPDACR-ERHPTAF 430
            |||||.::.:      :.:.|||::.:|:..:|.|..|: .:..:|.|.|||....| ..||.|.
plant   450 LASEDMKLGN------LEIPKGTTIILPIAKMHRDKAVWGSDADKFNPMRFANGLSRAANHPNAL 508

  Fly   431 LGFGDGPRNCIGLRFGRMQVKVGLITLLRRFRFSLPPGSPTQLKVTKRNLILLPSDGVRLQVDPV 495
            |.|..|||.|||..|..|:.|..|..:|:|||.:|   |.........:|.|.|...:.:.::|:
plant   509 LAFSMGPRACIGQNFAIMEAKTVLAMILQRFRLNL---SADYKHAPADHLTLQPQYDLPVILEPI 570

  Fly   496 E 496
            :
plant   571 D 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 127/483 (26%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 134/519 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.