DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a16 and Cyp3a71-ps

DIOPT Version :9

Sequence 1:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_008767252.2 Gene:Cyp3a71-ps / 690383 RGDID:1597309 Length:183 Species:Rattus norvegicus


Alignment Length:165 Identity:42/165 - (25%)
Similarity:73/165 - (44%) Gaps:28/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FTSGKMKYMFGTVSTVAQQLGGTFDELV------GSQGAVLELHDLMARYTTDVIGSCAFGTECS 190
            |||||:|.||..:     :|.|  |.||      ..:|..:.:.|:...|:.|||.|.:||....
  Rat     2 FTSGKLKVMFPII-----KLYG--DILVKYLRQEAEKGKPVSVKDIFGAYSMDVITSTSFGVNVD 59

  Fly   191 SLREPQAEFRQVGRRIFRNSNRS---IRWRIFKMTYLSSLAKLGLPVRILHPDITKFFNRIV--- 249
            ||..|:..|.:..::..|.....   |...:|  .:|..:..: |.:.:...|...||...|   
  Rat    60 SLNNPKDPFVEKTKKFLRLDYFDPLFISVELF--PFLKPIYDM-LNISVFPKDSIAFFKNFVYSM 121

  Fly   250 RET-VELRERENIRRNDFMDLLLDLRR--QENGKG 281
            :|: ::.:::..:   ||..|:::...  .|:.||
  Rat   122 KESHLDSKQKYQV---DFFQLMMNAHNNSSESHKG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 42/165 (25%)
Cyp3a71-psXP_008767252.2 cytochrome_P450 2..>153 CDD:425388 40/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.