DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a16 and CYP705A28

DIOPT Version :9

Sequence 1:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:356 Identity:83/356 - (23%)
Similarity:142/356 - (39%) Gaps:74/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 GTECSSLREPQAEFRQVGRRIFRNSNRSIRWRIF-KMTYLSSLAKLGL-----PVRILHPDITKF 244
            |..||   |...|..:|...:.  .:.::..:|| .|.:...|.|||:     .::.:.|...:.
plant     4 GRSCS---EKNGEAERVRGLVI--ESLALSPKIFLGMIFHKPLKKLGISLFQKDIKSVSPKFDEL 63

  Fly   245 FNRIVRETVELRERENIRRNDFMDLLLD------------LRRQENGK----------------G 281
            ..:.:.|..|..|.::.:.||.|||||:            ::|..|.|                .
plant    64 LEKFLVEHEEKMEEDHYKANDMMDLLLEAMEMRMQNVNLCIKRVSNTKARKPPILFRYGKYSNNS 128

  Fly   282 LTMEQMAAQAFVFFVAGFETSSSNMSYALFELAKNQDVQQKLRMEINDSIGKHGKLTYEAMMEMP 346
            |.::::       .|||.:||:....:.:.||..|..:.::||.||...:|....:....:..:|
plant   129 LLLQEL-------LVAGTDTSALATQWTMAELINNPTILERLREEIESVVGNTRLIQETDLSNLP 186

  Fly   347 YLDQTITETLRKYPALSSLTRLASEDYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVYPEPHE 411
            ||...:.|.||.:|..|...|::.|..|:    ||  ..:.:.|.:.:...||..||..:.:|.|
plant   187 YLQSVVKEGLRLHPPASISVRMSQERCEL----GG--FYIPEKTLLVVNTYAIMRDPNFWEDPEE 245

  Fly   412 FRPERFAPDACRERHP------TAFLGFGDGPRNCIG--LRFGRMQVKVGLITLLRRFRFS---- 464
            |:||||...:..|:..      ..::.|..|.|.|.|  |.:..:.:.:|::.....:|..    
plant   246 FKPERFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQCFDWRIKGEKV 310

  Fly   465 ----------LPPGSPTQLKVTKRNLILLPS 485
                      |....|.:.....|.|.||||
plant   311 NMSETAGTIMLAMAQPLKCTPVPRTLNLLPS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 83/356 (23%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 79/344 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.