DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45078 and fau

DIOPT Version :10

Sequence 1:NP_731506.1 Gene:CG45078 / 19836061 FlyBaseID:FBgn0266448 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_731505.1 Gene:fau / 41291 FlyBaseID:FBgn0266451 Length:131 Species:Drosophila melanogaster


Alignment Length:144 Identity:49/144 - (34%)
Similarity:64/144 - (44%) Gaps:37/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYESGFTTRRTYSSRPVTTSYAVTRTKRTPIDWEKVPFVPRPSLISDPVTAFGVRRPDLER-RQ 64
            |||||||||||||||||||||||||              .||..|.:|        ||...| |.
  Fly     1 MVYESGFTTRRTYSSRPVTTSYAVT--------------TPRLDLCTD--------RPGSHRSRA 43

  Fly    65 RSILDPINRASIKPDYKLAYEPIEP---------YVSTRDK-NRTRILGMVRQHID-TVEAGGNT 118
            .|.....:::|::   |.:|:...|         |.||.:| :|:...|......: |...|...
  Fly    44 SSDYSYTSKSSVE---KSSYDSSNPHSYRPERSTYTSTVEKTSRSGPGGSYNYSTERTSTTGAGP 105

  Fly   119 AGRTFRDSLDAQLP 132
            .|.::..:....||
  Fly   106 GGYSYSSTTSGNLP 119

Return to query results.
Submit another query.