powered by:
Protein Alignment CG44250 and AT1G49220
DIOPT Version :9
Sequence 1: | NP_001163133.1 |
Gene: | CG44250 / 19836034 |
FlyBaseID: | FBgn0265185 |
Length: | 297 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_175348.1 |
Gene: | AT1G49220 / 841345 |
AraportID: | AT1G49220 |
Length: | 251 |
Species: | Arabidopsis thaliana |
Alignment Length: | 68 |
Identity: | 14/68 - (20%) |
Similarity: | 25/68 - (36%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 238 IPPNAVTTGRARNG----ELLYYGRGHYQGSLT-PGLISASQRCLYIPYGGREIRI-----NSYE 292
:|..:.|.|.:..| .|..:....|...:. |||......||.....|.::|: :.:.
plant 95 VPSLSSTRGSSNKGIKKKALRMFPVVSYSPEMNLPGLDEECVICLSDFVSGEQLRLLPKCNHGFH 159
Fly 293 ILC 295
:.|
plant 160 VRC 162
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.