DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44250 and AT1G49220

DIOPT Version :9

Sequence 1:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_175348.1 Gene:AT1G49220 / 841345 AraportID:AT1G49220 Length:251 Species:Arabidopsis thaliana


Alignment Length:68 Identity:14/68 - (20%)
Similarity:25/68 - (36%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 IPPNAVTTGRARNG----ELLYYGRGHYQGSLT-PGLISASQRCLYIPYGGREIRI-----NSYE 292
            :|..:.|.|.:..|    .|..:....|...:. |||......||.....|.::|:     :.:.
plant    95 VPSLSSTRGSSNKGIKKKALRMFPVVSYSPEMNLPGLDEECVICLSDFVSGEQLRLLPKCNHGFH 159

  Fly   293 ILC 295
            :.|
plant   160 VRC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44250NP_001163133.1 DM9 13..84 CDD:128937
DUF3421 35..145 CDD:288732
DM9 85..155 CDD:128937
DM9 157..227 CDD:128937
DUF3421 178..287 CDD:288732 12/53 (23%)
DM9 228..297 CDD:128937 14/68 (21%)
AT1G49220NP_175348.1 RING-H2_EL5_like 134..177 CDD:319375 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.