DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44250 and CG5506

DIOPT Version :9

Sequence 1:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:160 Identity:44/160 - (27%)
Similarity:65/160 - (40%) Gaps:29/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTH 77
            ::.|...:....:|..||:||.|......||||..:....|||:||...|.||.   ..|.|.:.
  Fly    25 EHVWKAGNLSYVIPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTAYF---NTETTSSK 86

  Fly    78 ---YEVLVGQ---GFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLY 136
               |::||.:   .:.||.|..|.....||..|||...|.::..|....|.:.:|.         
  Fly    87 LLVYDILVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGT--------- 142

  Fly   137 IPFGGQEV-----------RINTYEVLIKQ 155
            :....|:|           :.:.||||:.|
  Fly   143 LLLSSQKVCIIKHESLALRKFDKYEVLVAQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44250NP_001163133.1 DM9 13..84 CDD:128937 24/73 (33%)
DUF3421 35..145 CDD:288732 33/126 (26%)
DM9 85..155 CDD:128937 19/80 (24%)
DM9 157..227 CDD:128937
DUF3421 178..287 CDD:288732
DM9 228..297 CDD:128937
CG5506NP_649021.1 DM9 25..96 CDD:128937 24/73 (33%)
DUF3421 47..161 CDD:288732 33/125 (26%)
DM9 100..172 CDD:128937 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.