DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44250 and uzip

DIOPT Version :10

Sequence 1:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_523861.1 Gene:uzip / 38002 FlyBaseID:FBgn0004055 Length:488 Species:Drosophila melanogaster


Alignment Length:133 Identity:36/133 - (27%)
Similarity:55/133 - (41%) Gaps:29/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVVTVDNTWVHSSPYSPLP----PYAVIGGH---DSDRTPIYVGRSFHEGENLPA---KVVPSKG 62
            |.:...:|.|..| |.|..    .:||.||.   :.:..|:||.|...:|..:..   |::....
  Fly    41 GQLVTSSTLVWES-YDPKDATQLQFAVEGGKYVTEDEHYPMYVCRVPIDGIQVSGHTEKILQRHV 104

  Fly    63 CAYVAYGGAEHTK-THYEVLVGQGFA-------WVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHH 119
            |....|   :|.| .:::||:.:|..       | .....|||..|:     |.|:..|:|| |.
  Fly   105 CLAAHY---KHGKYDNFDVLMNKGHLGKVGWRHW-RKFDAGVPVGAI-----RIGDDSYIGR-HR 159

  Fly   120 AGS 122
            |.|
  Fly   160 APS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44250NP_001163133.1 DUF3421 36..146 CDD:463390 26/98 (27%)
DUF3421 179..288 CDD:463390
uzipNP_523861.1 PFM_unzipped-like 233..367 CDD:380803
putative membrane-spanning region 260..300 CDD:380803
putative variable loop region 325..355 CDD:380803
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.