DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44250 and uzip

DIOPT Version :9

Sequence 1:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001286875.1 Gene:uzip / 38002 FlyBaseID:FBgn0004055 Length:488 Species:Drosophila melanogaster


Alignment Length:133 Identity:36/133 - (27%)
Similarity:55/133 - (41%) Gaps:29/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVVTVDNTWVHSSPYSPLP----PYAVIGGH---DSDRTPIYVGRSFHEGENLPA---KVVPSKG 62
            |.:...:|.|..| |.|..    .:||.||.   :.:..|:||.|...:|..:..   |::....
  Fly    41 GQLVTSSTLVWES-YDPKDATQLQFAVEGGKYVTEDEHYPMYVCRVPIDGIQVSGHTEKILQRHV 104

  Fly    63 CAYVAYGGAEHTK-THYEVLVGQGFA-------WVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHH 119
            |....|   :|.| .:::||:.:|..       | .....|||..|:     |.|:..|:|| |.
  Fly   105 CLAAHY---KHGKYDNFDVLMNKGHLGKVGWRHW-RKFDAGVPVGAI-----RIGDDSYIGR-HR 159

  Fly   120 AGS 122
            |.|
  Fly   160 APS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44250NP_001163133.1 DM9 13..84 CDD:128937 21/81 (26%)
DUF3421 35..145 CDD:288732 26/99 (26%)
DM9 85..155 CDD:128937 14/45 (31%)
DM9 157..227 CDD:128937
DUF3421 178..287 CDD:288732
DM9 228..297 CDD:128937
uzipNP_001286875.1 DUF3421 74..>159 CDD:331244 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.