DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44250 and CG10916

DIOPT Version :9

Sequence 1:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:159 Identity:65/159 - (40%)
Similarity:86/159 - (54%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTVDNTWV------HSSPYSPLPPY-AVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVA 67
            |.:|  ||      .|.|.:.|||. ||..|.:.|..|.||.|.::..:.|||..||.|..|:.:
  Fly   103 VAMD--WVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGS 165

  Fly    68 YGGAEHTKT-HYEVLV--GQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVH 129
            :..:..|.| ..|:||  ...:.|||...|..|.:|:.:|.:..||..|.|||.:.|.|.:||||
  Fly   166 HSCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVH 230

  Fly   130 PSHGCLYIPFGGQEVRINTYEVLIKQQHD 158
            |||..:|||..||||.:||||||:....|
  Fly   231 PSHKVMYIPHHGQEVSVNTYEVLVVTPRD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44250NP_001163133.1 DM9 13..84 CDD:128937 28/80 (35%)
DUF3421 35..145 CDD:288732 45/112 (40%)
DM9 85..155 CDD:128937 35/69 (51%)
DM9 157..227 CDD:128937 1/2 (50%)
DUF3421 178..287 CDD:288732
DM9 228..297 CDD:128937
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 28/79 (35%)
DUF3421 133..246 CDD:288732 45/112 (40%)
DM9 186..254 CDD:128937 34/67 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.