DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45069 and CG14374

DIOPT Version :9

Sequence 1:NP_001286841.1 Gene:CG45069 / 19836003 FlyBaseID:FBgn0266439 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_731809.1 Gene:CG14374 / 50026 FlyBaseID:FBgn0040553 Length:99 Species:Drosophila melanogaster


Alignment Length:129 Identity:85/129 - (65%)
Similarity:91/129 - (70%) Gaps:30/129 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLICLALCIAAAQAGFIASPVTTYAAAPAYAASYAAPVAYSAPVATYAAAAPAYSTYAAAAPA 65
            |||||||.|||||||||||||||.||||  .|:|  |||:|||||||||            :|||
  Fly     1 MKFLICLTLCIAAAQAGFIASPVATYAA--TYSA--AAPLAYSAPVATY------------SAPA 49

  Fly    66 YSTYAAAAPAYSTYAAAAPAYTASVYSAPAYTAPVTTYAAGAAYAAPVTTYSAPAIVSPILKKK 129
            |||||         |||.||     .|||||||||||||||.|||||:|||:|||:||..||||
  Fly    50 YSTYA---------AAAVPA-----LSAPAYTAPVTTYAAGTAYAAPITTYAAPAVVSSFLKKK 99



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.