powered by:
Protein Alignment CG45061 and CG45060
DIOPT Version :9
Sequence 1: | NP_001285063.1 |
Gene: | CG45061 / 19835998 |
FlyBaseID: | FBgn0266431 |
Length: | 76 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285062.1 |
Gene: | CG45060 / 19835394 |
FlyBaseID: | FBgn0266430 |
Length: | 76 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 23/73 - (31%) |
Similarity: | 40/73 - (54%) |
Gaps: | 7/73 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MHQLLLYSLCLWAVVVFCAPTPSESRRVIFLKPNGIH----RGQILATHGMEKSCPKCHMLDHRG 61
:.:||:.:..:.|:::..:|..:|:||:||..| | ..|:|.:..:.|.||...|.|||.
Fly 3 VQRLLILTFVVLAMILAQSPRITEARRLIFYNP---HTKPLTSQLLVSRRLTKPCPAGKMRDHRD 64
Fly 62 NCRRIIAY 69
.|||.:.:
Fly 65 RCRRAVIF 72
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45442659 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.