DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45546 and Y69H2.10

DIOPT Version :9

Sequence 1:NP_001287583.1 Gene:CG45546 / 19835889 FlyBaseID:FBgn0267106 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001024279.1 Gene:Y69H2.10 / 190560 WormBaseID:WBGene00013485 Length:572 Species:Caenorhabditis elegans


Alignment Length:54 Identity:19/54 - (35%)
Similarity:27/54 - (50%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QCSSKEIVSPCRSCERSCGQRETLDCVKDCRYGCICKMGWIRRNS-TCIPMSQC 88
            :||..|..|.|.:||:.|.|.....| |.|..||.|..|:.|..: .|:..::|
 Worm   519 KCSDNEAWSKCHNCEKVCFQTANPSC-KACWSGCGCLDGFSRSTTGLCVETAKC 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45546NP_001287583.1 TIL 37..88 CDD:280072 18/51 (35%)
Y69H2.10NP_001024279.1 TIL 386..438 CDD:280072
TIL 448..514 CDD:280072
TIL 520..571 CDD:280072 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.