DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45546 and LOC101733954

DIOPT Version :9

Sequence 1:NP_001287583.1 Gene:CG45546 / 19835889 FlyBaseID:FBgn0267106 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_012823040.1 Gene:LOC101733954 / 101733954 -ID:- Length:153 Species:Xenopus tropicalis


Alignment Length:96 Identity:30/96 - (31%)
Similarity:48/96 - (50%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAHLQLY--ILALILVTSMWNIQTSNGSVQLMLRLYFQCSSKEIVSPCRSCERSCGQ-RETLD-C 61
            ||..|.|  :||:.|| .|.|:|:.:...|      .:|.:..:....|.|..:|.. ..|.| |
 Frog     1 MATWQNYSFLLAMALV-FMANVQSQDAPPQ------GRCPADMVYGCKRVCFSNCDNLNSTRDVC 58

  Fly    62 VKDCRYGCICKMGWI---RRNSTCIPMSQCE 89
            :..|..||.||.|::   :.::||:|:|.|:
 Frog    59 ILMCPIGCDCKEGFVFKSKDSNTCVPVSACK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45546NP_001287583.1 TIL 37..88 CDD:280072 17/55 (31%)
LOC101733954XP_012823040.1 TIL 32..88 CDD:366828 17/55 (31%)
TIL 92..148 CDD:366828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 1 1.000 - - FOG0006730
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X701
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.