DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45546 and LOC100487969

DIOPT Version :10

Sequence 1:NP_001287583.1 Gene:CG45546 / 19835889 FlyBaseID:FBgn0267106 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_002941834.2 Gene:LOC100487969 / 100487969 XenbaseID:XB-GENE-29079007 Length:162 Species:Xenopus tropicalis


Alignment Length:54 Identity:14/54 - (25%)
Similarity:25/54 - (46%) Gaps:13/54 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RSCERSC--------GQRETLDCVKDCRYGCICKMGWI---RRNSTCIPMSQCE 89
            :.|:|:|        ...||  |:..|...|.|..|::   .::|.|:.:|.|:
 Frog    44 KGCKRNCFNTCDNLNSTSET--CIGPCTLDCDCVDGFVFESDQSSVCVNVSTCK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45546NP_001287583.1 TIL 37..88 CDD:410995 13/51 (25%)
LOC100487969XP_002941834.2 TIL 37..94 CDD:410995 13/51 (25%)
TIL 98..156 CDD:410995
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.