DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and RMA3

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_194477.2 Gene:RMA3 / 828856 AraportID:AT4G27470 Length:243 Species:Arabidopsis thaliana


Alignment Length:110 Identity:34/110 - (30%)
Similarity:50/110 - (45%) Gaps:26/110 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MEG-------LRRAGD-GMKTLETVDLTTDDEERPVLRLLSDRNNGHYLCPICMSLPDHPVATTC 72
            |||       .:||.| |....:..:|||    .|.....::  :|.:.|.||:.....||.|.|
plant     1 MEGNFFIRSDAQRAHDNGFIAKQKPNLTT----APTAGQANE--SGCFDCNICLDTAHDPVVTLC 59

  Fly    73 GHIFCKECLTTALN-QL---------HYCPLCKN--FVTSFFRIY 105
            ||:||..|:...|: ||         :.||:||:  .:||...:|
plant    60 GHLFCWPCIYKWLHVQLSSVSVDQHQNNCPVCKSNITITSLVPLY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 17/47 (36%)
RMA3NP_194477.2 PLN03208 37..228 CDD:178747 23/70 (33%)
RING 43..95 CDD:238093 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.