DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and AT2G42030

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_181733.1 Gene:AT2G42030 / 818803 AraportID:AT2G42030 Length:425 Species:Arabidopsis thaliana


Alignment Length:87 Identity:28/87 - (32%)
Similarity:48/87 - (55%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MEGLRRAGDGMKTLETVDLTTDDEERPVLRLLSDRNNGHYL-CPICMSLPDHPVATTCGHIFCKE 79
            :|..::..:|.|.:...::|  :|:|.|.:  |..::|.:. |.||:.|...||.|.|||::|..
plant   103 IEDSKKCENGSKVMAEDNVT--EEKRDVEK--SVGSDGSFFDCYICLDLSKDPVVTNCGHLYCWS 163

  Fly    80 CLTTAL--NQLHYCPLCKNFVT 99
            ||...|  ::...||:||..|:
plant   164 CLYQWLQVSEAKECPVCKGEVS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 25/80 (31%)
RING_Ubox 57..>99 CDD:473075 18/43 (42%)
AT2G42030NP_181733.1 PLN03208 124..>214 CDD:178747 24/64 (38%)
RING-HC_RNF5-like 139..181 CDD:438196 16/41 (39%)

Return to query results.
Submit another query.