DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and AT2G23780

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_179958.1 Gene:AT2G23780 / 816910 AraportID:AT2G23780 Length:227 Species:Arabidopsis thaliana


Alignment Length:63 Identity:25/63 - (39%)
Similarity:30/63 - (47%) Gaps:15/63 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SDRNN------GHYLCPICMSLPDHPVATTCGHIFCKECLTTALNQLHY------CPLCKNFV 98
            ||.||      |.:.|.||..|...|:.|.|||:||..||   ...||:      ||:||..|
plant    13 SDSNNDTNDQGGDFECNICFELAQDPIVTLCGHLFCWPCL---YRWLHHHSHSQECPVCKAVV 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 22/57 (39%)
RING_Ubox 57..>99 CDD:473075 20/48 (42%)
AT2G23780NP_179958.1 RING-HC_AtRMA-like 26..70 CDD:438403 18/46 (39%)

Return to query results.
Submit another query.