DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and btr05

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_021333400.1 Gene:btr05 / 794264 ZFINID:ZDB-GENE-080219-8 Length:507 Species:Danio rerio


Alignment Length:87 Identity:27/87 - (31%)
Similarity:41/87 - (47%) Gaps:20/87 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLKMEGLRRAGDGMKTLETVD--LTTDDEERPVLRLLSDRNNGHYLCPICMSLPDHPVATTCGHI 75
            ||.|...:|.        ::|  |:.....||:...|.        |.:|:.:...||:|.|||.
Zfish     8 PLPMRTTKRL--------SMDRSLSLSSSMRPLFEELQ--------CSVCLDVFTDPVSTPCGHN 56

  Fly    76 FCKECLTTAL--NQLHYCPLCK 95
            |||.||.::.  :|:..||||:
Zfish    57 FCKSCLNSSWENSQVCSCPLCR 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 17/39 (44%)
btr05XP_021333400.1 RING_Ubox 35..78 CDD:327409 18/50 (36%)
zf-B_box 164..200 CDD:306989
SMC_N <200..>265 CDD:330553
SPRY_PRY_C-I_1 329..501 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.