DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG44271 and BRCA1

DIOPT Version :9

Sequence 1:	NP_001285689.1	Gene:	CG44271 / 19835868	FlyBaseID:	FBgn0265257	Length:	106	Species:	Drosophila melanogaster
Sequence 2:	NP_009231.2	Gene:	BRCA1 / 672	HGNCID:	1100	Length:	1884	Species:	Homo sapiens

Alignment Length:	46	Identity:	25/46 - (54%)
Similarity:	29/46 - (63%)	Gaps:	3/46 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    57 CPICMSLPDHPVATTCGHIFCKECLTTALNQL---HYCPLCKNFVT 99
            ||||:.|...||:|.|.|||||.|:...|||.   ..||||||.:|
Human    24 CPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDIT 69

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG44271	NP_001285689.1	RING	57..95	CDD:238093	21/40 (53%)
BRCA1	NP_009231.2	RING	23..68	CDD:238093	24/43 (56%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	230..270
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	306..338
		BRCT_assoc	345..507	CDD:289581
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	534..570
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	654..709
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1181..1216
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1322..1387
		Interaction with PALB2. /evidence=ECO:0000269\|PubMed:19369211	1397..1424
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1586..1617
		BRCT	1671..1745	CDD:237994
		BRCT	1779..1863	CDD:214602
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm42023
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.910