DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and BRCA1

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001394510.1 Gene:BRCA1 / 672 HGNCID:1100 Length:1885 Species:Homo sapiens


Alignment Length:46 Identity:25/46 - (54%)
Similarity:29/46 - (63%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CPICMSLPDHPVATTCGHIFCKECLTTALNQL---HYCPLCKNFVT 99
            ||||:.|...||:|.|.|||||.|:...|||.   ..||||||.:|
Human    24 CPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDIT 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 20/39 (51%)
RING_Ubox 57..>99 CDD:473075 24/44 (55%)
BRCA1NP_001394510.1 RING-HC_BRCA1 7..99 CDD:438161 25/46 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..270
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338
BRCT_assoc 345..508 CDD:463719
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..709
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1181..1216
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1322..1387
Interaction with PALB2. /evidence=ECO:0000269|PubMed:19369211 1397..1424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1587..1618
BRCT_BRCA1_rpt1 1672..1768 CDD:349367
BRCT_BRCA1_rpt2 1780..1877 CDD:349353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.