DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Rnf5

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_062276.1 Gene:Rnf5 / 54197 MGIID:1860076 Length:180 Species:Mus musculus


Alignment Length:42 Identity:15/42 - (35%)
Similarity:20/42 - (47%) Gaps:3/42 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CPICMSLPDHPVATTCGHIFCKECLTTALN---QLHYCPLCK 95
            |.||:......|.:.|||::|..||...|.   ....||:||
Mouse    27 CNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQECPVCK 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 13/40 (33%)
Rnf5NP_062276.1 PLN03208 25..>117 CDD:178747 15/42 (36%)
RING-HC_RNF5 25..70 CDD:319657 15/42 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.