DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and PEX10

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens


Alignment Length:57 Identity:24/57 - (42%)
Similarity:31/57 - (54%) Gaps:8/57 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EERPVLRLLSDRNNGHYLCPICMSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCK 95
            |||.|.|        :.||.:|:....||.||.|||:||.||:|...:....||||:
Human   283 EERAVSR--------NPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 22/54 (41%)
RING_Ubox 57..>99 CDD:473075 18/39 (46%)
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:398431
RING-HC_PEX10 293..342 CDD:438190 18/39 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.