DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Brca1

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_036646.2 Gene:Brca1 / 497672 RGDID:2218 Length:1817 Species:Rattus norvegicus


Alignment Length:46 Identity:25/46 - (54%)
Similarity:29/46 - (63%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CPICMSLPDHPVATTCGHIFCKECLTTALNQL---HYCPLCKNFVT 99
            ||||:.|...||:|.|.|||||.|:...|||.   ..||||||.:|
  Rat    24 CPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNEIT 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 21/40 (53%)
Brca1NP_036646.2 RING-HC_BRCA1 18..65 CDD:319412 21/40 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..347
BRCT_assoc 343..504 CDD:403887
Nuclear localization signal. /evidence=ECO:0000255 497..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..560
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 617..768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 875..907
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 959..982
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1145..1180
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1259..1290
Interaction with PALB2. /evidence=ECO:0000250 1354..1381
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1373..1534
BRCT_BRCA1_rpt1 1596..1692 CDD:349367
BRCT_BRCA1_rpt2 1703..1800 CDD:349353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46168
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.