DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and rnf185

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_998202.1 Gene:rnf185 / 406310 ZFINID:ZDB-GENE-040426-1977 Length:194 Species:Danio rerio


Alignment Length:43 Identity:17/43 - (39%)
Similarity:22/43 - (51%) Gaps:5/43 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CPICMSLPDHPVATTCGHIFCKEC----LTTALNQLHYCPLCK 95
            |.||:......|.:.|||:||..|    |.|..|: ..||:||
Zfish    41 CNICLDTSKDAVISLCGHLFCWPCLHQWLETRPNR-QVCPVCK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 15/40 (38%)
RING_Ubox 57..>99 CDD:473075 17/43 (40%)
rnf185NP_998202.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1 31..82 15/41 (37%)
RING-HC_RNF185 39..95 CDD:438402 17/43 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..126
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.