Protein Alignment CG44271 and rnf185

DIOPT Version :9

• Sequence 1: NP_001285689.1
• Gene: CG44271 / 19835868
• FlyBaseID: FBgn0265257
• Length: 106
• Species: Drosophila melanogaster
• Sequence 2: NP_998202.1
• Gene: rnf185 / 406310
• ZFINID: ZDB-GENE-040426-1977
• Length: 194
• Species: Danio rerio
• Alignment Length: 43
• Identity: 17/43 - (39%)
• Similarity: 22/43 - (51%)
• Gaps: 5/43 - (11%)

  Fly    57 CPICMSLPDHPVATTCGHIFCKEC----LTTALNQLHYCPLCK 95
            |.||:......|.:.|||:||..|    |.|..|: ..||:||
Zfish    41 CNICLDTSKDAVISLCGHLFCWPCLHQWLETRPNR-QVCPVCK 82

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG44271	NP_001285689.1	RING	57..95	CDD:238093	15/41 (37%)
rnf185	NP_998202.1	Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	1..32
		Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1	31..82		15/41 (37%)
		RING	40..85	CDD:238093	17/43 (40%)
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	92..126

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1510545at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010