powered by:
Protein Alignment CG44271 and Lonrf2
DIOPT Version :9
Sequence 1: | NP_001285689.1 |
Gene: | CG44271 / 19835868 |
FlyBaseID: | FBgn0265257 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001025049.2 |
Gene: | Lonrf2 / 381338 |
MGIID: | 1920209 |
Length: | 754 |
Species: | Mus musculus |
Alignment Length: | 58 |
Identity: | 24/58 - (41%) |
Similarity: | 32/58 - (55%) |
Gaps: | 4/58 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 EERPVLRLLSDRNNGHYLCPICMSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKN 96
||.|...: |..: :.|.:||.|...||.|.|||.||.:||...|:...:|||||:
Mouse 435 EEEPEFTI--DATD--FECALCMRLLFEPVTTPCGHTFCLKCLERCLDHAPHCPLCKD 488
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.