DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Lonrf2

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001025049.2 Gene:Lonrf2 / 381338 MGIID:1920209 Length:754 Species:Mus musculus


Alignment Length:58 Identity:24/58 - (41%)
Similarity:32/58 - (55%) Gaps:4/58 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EERPVLRLLSDRNNGHYLCPICMSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKN 96
            ||.|...:  |..:  :.|.:||.|...||.|.|||.||.:||...|:...:|||||:
Mouse   435 EEEPEFTI--DATD--FECALCMRLLFEPVTTPCGHTFCLKCLERCLDHAPHCPLCKD 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 18/37 (49%)
Lonrf2NP_001025049.2 TPR_16 27..90 CDD:338738
RING1-HC_LONFs 136..>161 CDD:319427
TPR repeat 223..253 CDD:276809
TPR repeat 258..281 CDD:276809
RING2-HC_LONFs 446..487 CDD:319428 18/42 (43%)
RING-HC finger (C3HC4-type) 449..486 CDD:319428 17/36 (47%)
LON_substr_bdg 538..738 CDD:308028
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.