powered by:
Protein Alignment CG44271 and Rnf185
DIOPT Version :9
Sequence 1: | NP_001285689.1 |
Gene: | CG44271 / 19835868 |
FlyBaseID: | FBgn0265257 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001019442.1 |
Gene: | Rnf185 / 360967 |
RGDID: | 1564777 |
Length: | 192 |
Species: | Rattus norvegicus |
Alignment Length: | 43 |
Identity: | 17/43 - (39%) |
Similarity: | 22/43 - (51%) |
Gaps: | 5/43 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 CPICMSLPDHPVATTCGHIFCKEC----LTTALNQLHYCPLCK 95
|.||:......|.:.|||:||..| |.|..|: ..||:||
Rat 39 CNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNR-QVCPVCK 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.