DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Y47G6A.31

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001021767.2 Gene:Y47G6A.31 / 3565969 WormBaseID:WBGene00044436 Length:185 Species:Caenorhabditis elegans


Alignment Length:49 Identity:17/49 - (34%)
Similarity:20/49 - (40%) Gaps:9/49 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CPIC-------MSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKNFV 98
            |.||       ..||  .:...|||.||..||...|.....||:|:..|
 Worm     7 CSICFFDFDDFQHLP--KLLENCGHTFCYSCLFDWLKSQDTCPMCREAV 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 15/44 (34%)
Y47G6A.31NP_001021767.2 RAD18 3..>51 CDD:227719 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.