powered by:
Protein Alignment CG44271 and Y47G6A.31
DIOPT Version :9
Sequence 1: | NP_001285689.1 |
Gene: | CG44271 / 19835868 |
FlyBaseID: | FBgn0265257 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021767.2 |
Gene: | Y47G6A.31 / 3565969 |
WormBaseID: | WBGene00044436 |
Length: | 185 |
Species: | Caenorhabditis elegans |
Alignment Length: | 49 |
Identity: | 17/49 - (34%) |
Similarity: | 20/49 - (40%) |
Gaps: | 9/49 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 CPIC-------MSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKNFV 98
|.|| ..|| .:...|||.||..||...|.....||:|:..|
Worm 7 CSICFFDFDDFQHLP--KLLENCGHTFCYSCLFDWLKSQDTCPMCREAV 53
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG44271 | NP_001285689.1 |
RING |
57..95 |
CDD:238093 |
15/44 (34%) |
Y47G6A.31 | NP_001021767.2 |
RAD18 |
3..>51 |
CDD:227719 |
16/45 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.