DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Y47G6A.31

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001021767.2 Gene:Y47G6A.31 / 3565969 WormBaseID:WBGene00044436 Length:185 Species:Caenorhabditis elegans


Alignment Length:49 Identity:17/49 - (34%)
Similarity:20/49 - (40%) Gaps:9/49 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CPIC-------MSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKNFV 98
            |.||       ..||  .:...|||.||..||...|.....||:|:..|
 Worm     7 CSICFFDFDDFQHLP--KLLENCGHTFCYSCLFDWLKSQDTCPMCREAV 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 15/43 (35%)
RING_Ubox 57..>99 CDD:473075 17/49 (35%)
Y47G6A.31NP_001021767.2 RAD18 3..>51 CDD:227719 16/45 (36%)

Return to query results.
Submit another query.