DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Lonrf1

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_017455861.2 Gene:Lonrf1 / 306505 RGDID:1562583 Length:797 Species:Rattus norvegicus


Alignment Length:45 Identity:22/45 - (48%)
Similarity:26/45 - (57%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CPICMSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKNFVTSF 101
            |.:||.|...||.|.|||.|||.||...|:...||||||..:..:
  Rat   503 CSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEY 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 20/37 (54%)
Lonrf1XP_017455861.2 RING_Ubox 154..190 CDD:418438
RING-HC finger (C3HC4-type) 154..189 CDD:319361
TPR <209..336 CDD:223533
TPR repeat 237..264 CDD:276809
TPR repeat 269..299 CDD:276809
TPR repeat 304..332 CDD:276809
PEX10 <455..551 CDD:227861 22/45 (49%)
RING2-HC_LONFs 500..541 CDD:319428 20/37 (54%)
LON_substr_bdg 591..789 CDD:396663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.