powered by:
Protein Alignment CG44271 and Lonrf1
DIOPT Version :9
Sequence 1: | NP_001285689.1 |
Gene: | CG44271 / 19835868 |
FlyBaseID: | FBgn0265257 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017455861.2 |
Gene: | Lonrf1 / 306505 |
RGDID: | 1562583 |
Length: | 797 |
Species: | Rattus norvegicus |
Alignment Length: | 45 |
Identity: | 22/45 - (48%) |
Similarity: | 26/45 - (57%) |
Gaps: | 0/45 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 CPICMSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKNFVTSF 101
|.:||.|...||.|.|||.|||.||...|:...||||||..:..:
Rat 503 CSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEY 547
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.