DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Rnf4

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_062055.1 Gene:Rnf4 / 29274 RGDID:3583 Length:194 Species:Rattus norvegicus


Alignment Length:106 Identity:29/106 - (27%)
Similarity:43/106 - (40%) Gaps:35/106 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RRAGDGMKT--LETVDLTTDDEERPVLRLLSD---------------------RNNGHYLCPICM 61
            ||.|..::.  .::..:::||||     |..|                     |.:|...|||||
  Rat    81 RRNGRRLRQDHADSCVVSSDDEE-----LSKDKDVYVTTHTPRSTKDEGTTGLRPSGTVSCPICM 140

  Fly    62 SLPDH-------PVATTCGHIFCKECLTTALNQLHYCPLCK 95
            .....       .|:|.|||:||.:||..:|...:.||.|:
  Rat   141 DGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 17/44 (39%)
Rnf4NP_062055.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Required for ubiquitination activity. /evidence=ECO:0000250 1..20
Mediates interaction with TRPS1. /evidence=ECO:0000250 6..65
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 40..43
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 50..53
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 61..63
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 71..74
RING-HC_RNF4 131..184 CDD:319447 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11266
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 1 1.000 - - otm45623
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.