DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Rnf4

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_062055.1 Gene:Rnf4 / 29274 RGDID:3583 Length:194 Species:Rattus norvegicus


Alignment Length:106 Identity:29/106 - (27%)
Similarity:43/106 - (40%) Gaps:35/106 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RRAGDGMKT--LETVDLTTDDEERPVLRLLSD---------------------RNNGHYLCPICM 61
            ||.|..::.  .::..:::||||     |..|                     |.:|...|||||
  Rat    81 RRNGRRLRQDHADSCVVSSDDEE-----LSKDKDVYVTTHTPRSTKDEGTTGLRPSGTVSCPICM 140

  Fly    62 SLPDH-------PVATTCGHIFCKECLTTALNQLHYCPLCK 95
            .....       .|:|.|||:||.:||..:|...:.||.|:
  Rat   141 DGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 28/103 (27%)
RING_Ubox 57..>99 CDD:473075 18/46 (39%)
Rnf4NP_062055.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Required for ubiquitination activity. /evidence=ECO:0000250|UniProtKB:Q9QZS2 1..20
Mediates interaction with TRPS1. /evidence=ECO:0000250|UniProtKB:Q9QZS2 6..65
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 40..43
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 50..53
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 61..63
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 71..74
RING-HC_RNF4 131..187 CDD:438195 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.