DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and Lonrf1

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001074619.2 Gene:Lonrf1 / 244421 MGIID:3609241 Length:762 Species:Mus musculus


Alignment Length:123 Identity:34/123 - (27%)
Similarity:50/123 - (40%) Gaps:35/123 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLKMEGLRRA---------GDG------MKTLETVDLTTDDEERPVLRLLSDRNN---------- 52
            |.:.:||:|.         |.|      :..||. |:..:::.|..|:..|:..:          
Mouse   391 PAREDGLKRVCSEPLLSAQGKGVLLKRKLSLLEQ-DVLINEDGRSKLKKQSESPSEDCMFSIAYG 454

  Fly    53 ---------GHYLCPICMSLPDHPVATTCGHIFCKECLTTALNQLHYCPLCKNFVTSF 101
                     ..:.|.:||.|...||.|.|||.|||.||...|:...||||||..:..:
Mouse   455 DIPEELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEY 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 20/37 (54%)
Lonrf1NP_001074619.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
TPR 1. /evidence=ECO:0000255 47..80
TPR 2. /evidence=ECO:0000255 201..233
TPR 3. /evidence=ECO:0000255 235..267
TPR 4. /evidence=ECO:0000255 268..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.