DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and rnf-5

DIOPT Version :10

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_497830.1 Gene:rnf-5 / 175532 WormBaseID:WBGene00004381 Length:235 Species:Caenorhabditis elegans


Alignment Length:69 Identity:22/69 - (31%)
Similarity:32/69 - (46%) Gaps:8/69 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TTDDEERPVLRLLSDRNNGHYLCPICMSLPDHPVATTCGHIFCKECLTTAL-----NQLHYCPLC 94
            |....|.|......| .:..:.|.||:......|.:.|||:||..||:..|     ||:  ||:|
 Worm     5 TKAPSEEPTSSSNKD-ESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQV--CPVC 66

  Fly    95 KNFV 98
            |:.:
 Worm    67 KSAI 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 20/63 (32%)
RING_Ubox 57..>99 CDD:473075 18/47 (38%)
rnf-5NP_497830.1 RING-HC_RNF185 24..80 CDD:438402 18/49 (37%)

Return to query results.
Submit another query.