powered by:
Protein Alignment CG44271 and rnf-5
DIOPT Version :9
Sequence 1: | NP_001285689.1 |
Gene: | CG44271 / 19835868 |
FlyBaseID: | FBgn0265257 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497830.1 |
Gene: | rnf-5 / 175532 |
WormBaseID: | WBGene00004381 |
Length: | 235 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 22/69 - (31%) |
Similarity: | 32/69 - (46%) |
Gaps: | 8/69 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 TTDDEERPVLRLLSDRNNGHYLCPICMSLPDHPVATTCGHIFCKECLTTAL-----NQLHYCPLC 94
|....|.|......| .:..:.|.||:......|.:.|||:||..||:..| ||: ||:|
Worm 5 TKAPSEEPTSSSNKD-ESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQV--CPVC 66
Fly 95 KNFV 98
|:.:
Worm 67 KSAI 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG44271 | NP_001285689.1 |
RING |
57..95 |
CDD:238093 |
16/42 (38%) |
rnf-5 | NP_497830.1 |
RING |
25..70 |
CDD:238093 |
18/46 (39%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.