DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44271 and LOC100495443

DIOPT Version :9

Sequence 1:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_002943039.2 Gene:LOC100495443 / 100495443 -ID:- Length:542 Species:Xenopus tropicalis


Alignment Length:77 Identity:26/77 - (33%)
Similarity:34/77 - (44%) Gaps:25/77 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RP-VLRLLSDRNNGHYL----------------CPICMSLPDHPVATTCGHIFCKECLTTALNQL 88
            || ||||:|   ..|::                |.||:.|..|||...|||.||:.|:...||..
 Frog     6 RPSVLRLMS---YFHFVFLLPAMAAADLREELNCSICLDLYTHPVMLPCGHNFCQGCIKEVLNSQ 67

  Fly    89 -----HYCPLCK 95
                 :.||.|:
 Frog    68 GGSGGYSCPECR 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44271NP_001285689.1 RING 57..95 CDD:238093 17/42 (40%)
LOC100495443XP_002943039.2 RING_Ubox 33..79 CDD:388418 17/45 (38%)
Bbox_SF 111..153 CDD:381767
Bbox2_TRIM16-like 160..206 CDD:380827
BBC 205..317 CDD:128778
SPRY_PRY_C-I_2 374..541 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.