powered by:
Protein Alignment CG44271 and XB5836481
DIOPT Version :9
Sequence 1: | NP_001285689.1 |
Gene: | CG44271 / 19835868 |
FlyBaseID: | FBgn0265257 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002941273.1 |
Gene: | XB5836481 / 100490164 |
XenbaseID: | XB-GENE-5836482 |
Length: | 536 |
Species: | Xenopus tropicalis |
Alignment Length: | 45 |
Identity: | 13/45 - (28%) |
Similarity: | 21/45 - (46%) |
Gaps: | 6/45 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 CPICMSLPDHPVATTCGHIFCKECL------TTALNQLHYCPLCK 95
|.:|:::...||...|||.||..|: ...:.:...||.|:
Frog 13 CTVCLNIYTEPVTLPCGHNFCLSCIGKTWDWQEGIEEQPSCPECR 57
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.