DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44245 and GYG2

DIOPT Version :10

Sequence 1:NP_001286669.1 Gene:CG44245 / 19835749 FlyBaseID:FBgn0265180 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_003909.2 Gene:GYG2 / 8908 HGNCID:4700 Length:501 Species:Homo sapiens


Alignment Length:140 Identity:28/140 - (20%)
Similarity:53/140 - (37%) Gaps:31/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 VTQNIEITENNRTVRKNSLQEQNVKAITTTSNTSSSDKKQKKKPKSSAPPPPADFFQNDTTSVAS 257
            |.:.:.:.|..|:....:..|....|:.|..            |.|...|.||||.:.:|....:
Human   363 VDETLSLPEGRRSEDMIACPETETPAVITCD------------PLSQPSPQPADFTETETILQPA 415

  Fly   258 KRVPGGVEYTYSTQLDSGKTITTSKTVYEEEEVELTEEEIRQYKKTLKDAEKHKNVSTTKKLKSE 322
            .:|               :::::.:|.  |...||..|.:|.  .:|:||.:.....:..::..|
Human   416 NKV---------------ESVSSEETF--EPSQELPAEALRD--PSLQDALEVDLAVSVSQISIE 461

  Fly   323 SGTKKIVPSE 332
            ...|::.|.|
Human   462 EKVKELSPEE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44245NP_001286669.1 None
GYG2NP_003909.2 GT8_Glycogenin 37..288 CDD:133018
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.