DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44247 and NPDC1

DIOPT Version :9

Sequence 1:NP_611974.2 Gene:CG44247 / 19835727 FlyBaseID:FBgn0265182 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_056207.3 Gene:NPDC1 / 56654 HGNCID:7899 Length:325 Species:Homo sapiens


Alignment Length:294 Identity:87/294 - (29%)
Similarity:128/294 - (43%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 RERIP---FAVGPSDARFFDNP---------NDPSGELDSRALEDYEEYAPIEPTTEVATTASKT 231
            |.|.|   .|.||....|.::.         ..|.|......|||..::.    ..|:|...|..
Human    53 RARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFL----AQELARKESGH 113

  Fly   232 KIDTPVPAPVPVEPPKLLDAANTNFHRINPQSAAAAAVAGVNIPQSKEQP---PH-ELNALINKL 292
              .||   |:|.:..:|.:.|...|       :|......:.:|.:...|   || .|.:.:   
Human   114 --STP---PLPKDRQRLPEPATLGF-------SARGQGLELGLPSTPGTPTPTPHTSLGSPV--- 163

  Fly   293 QKQSKAPSHLTLV--NGGDSSQEQIVLRQHLGMNSEMGVYIVALIAGVSAAVTVGLLALGVTWFH 355
               |..|.|::.:  .||......:||             |:|.....:||::|..|.    |..
Human   164 ---SSDPVHMSPLEPRGGQGDGLALVL-------------ILAFCVAGAAALSVASLC----WCR 208

  Fly   356 NRHKAAADVEYPAYGVTGPNKDVSP---SGDRKLAQSAQMYHYQHQKQQIIAMENQATDGSCGMS 417
            .:.:.....:........|....:|   .||::|||||:|||||||:||::.:|.. .:....:.
Human   209 LQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERH-KEPPKELD 272

  Fly   418 DVESDDDNEEGDYTVYECPGLAPTGEMEVKNPLF 451
            ...||::||:||:||||||||||||||||:||||
Human   273 TASSDEENEDGDFTVYECPGLAPTGEMEVRNPLF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44247NP_611974.2 NPDC1 <329..459 CDD:284276 52/126 (41%)
NPDC1NP_056207.3 NPDC1 1..308 CDD:284276 87/294 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..175 8/42 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..290 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004167
OrthoInspector 1 1.000 - - oto90895
orthoMCL 1 0.900 - - OOG6_108176
Panther 1 1.100 - - LDO PTHR23352
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5781
SonicParanoid 1 1.000 - - X3987
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.