DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44247 and Npdc1

DIOPT Version :9

Sequence 1:NP_611974.2 Gene:CG44247 / 19835727 FlyBaseID:FBgn0265182 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_017447118.1 Gene:Npdc1 / 296562 RGDID:1303156 Length:348 Species:Rattus norvegicus


Alignment Length:250 Identity:77/250 - (30%)
Similarity:111/250 - (44%) Gaps:53/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 INPQSAAAAAVAGVNIPQSKEQPPHELNALINKLQKQSKAPSH--LTLVNGGDSSQEQIVLRQHL 321
            :.|....|...:|..:||.:.:  .|:::|..:|..:.|...|  ||.....::||:.:.....|
  Rat    92 LGPLYMKAHHSSGEGLPQPRLE--EEIDSLARELALKEKEAGHPRLTAQPLPEASQKLLEPAATL 154

  Fly   322 GMNS-----EMGV-------------------------------------YIVALIAGVSAAVTV 344
            |.:.     |.|:                                     ..:.||.....|.|.
  Rat   155 GFSQWGQQLEPGLPSTHGTSSPTPHTSLSARASSGPVQMSPLEPQGRGNGLALVLILAFCLASTA 219

  Fly   345 GLLALGVTWFHNRHK----AAADVEYPAYGVTGPNKD-VSPSGDRKLAQSAQMYHYQHQKQQIIA 404
            .|....:.|...:.:    ..||....|.|.|.|... :|| ||.:||.||:|||||||:||::.
  Rat   220 ALAVAALCWCRLQREIRLTQKADYTATAKGPTSPTTPRISP-GDERLAHSAEMYHYQHQRQQMLC 283

  Fly   405 MENQATDGSCGMSDVESDDDNEEGDYTVYECPGLAPTGEMEVKNPLFLDETPATP 459
            :|.. .|....:....||::||:||:||||||||||||||||:||||...|.:.|
  Rat   284 LERH-KDPPKELESASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHSTLSAP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44247NP_611974.2 NPDC1 <329..459 CDD:284276 58/171 (34%)
Npdc1XP_017447118.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004167
OrthoInspector 1 1.000 - - oto97990
orthoMCL 1 0.900 - - OOG6_108176
Panther 1 1.100 - - LDO PTHR23352
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3987
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.