DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and Spink12

DIOPT Version :9

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_084337.2 Gene:Spink12 / 78242 MGIID:1925492 Length:87 Species:Mus musculus


Alignment Length:59 Identity:19/59 - (32%)
Similarity:27/59 - (45%) Gaps:16/59 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FIALCLLAFVVLTEAQVT------------RPLCP----CPRIYFPVCGSDHVTYTNSC 48
            |:.|..||.:.|:...|:            :.|.|    ||:.:.||||:|..||.|.|
Mouse     7 FLLLISLACLFLSVDAVSQGGFQAFCSNYEKTLAPDGKSCPKTHKPVCGTDGKTYQNRC 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 12/26 (46%)
Spink12NP_084337.2 KAZAL_PSTI 42..87 CDD:238648 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1636538at2759
OrthoFinder 1 1.000 - - FOG0000146
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.