powered by:
Protein Alignment CG45011 and Spink12
DIOPT Version :9
Sequence 1: | NP_001285848.1 |
Gene: | CG45011 / 19835723 |
FlyBaseID: | FBgn0266363 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_084337.2 |
Gene: | Spink12 / 78242 |
MGIID: | 1925492 |
Length: | 87 |
Species: | Mus musculus |
Alignment Length: | 59 |
Identity: | 19/59 - (32%) |
Similarity: | 27/59 - (45%) |
Gaps: | 16/59 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 FIALCLLAFVVLTEAQVT------------RPLCP----CPRIYFPVCGSDHVTYTNSC 48
|:.|..||.:.|:...|: :.|.| ||:.:.||||:|..||.|.|
Mouse 7 FLLLISLACLFLSVDAVSQGGFQAFCSNYEKTLAPDGKSCPKTHKPVCGTDGKTYQNRC 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1636538at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000146 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.