DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and LOC4577980

DIOPT Version :10

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:XP_001230687.2 Gene:LOC4577980 / 4577980 VectorBaseID:AGAMI1_012281 Length:101 Species:Anopheles gambiae


Alignment Length:85 Identity:29/85 - (34%)
Similarity:35/85 - (41%) Gaps:22/85 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PIFIAL-CLLAFVVLTEAQVTR-------------------PLCPCPRIYFPVCGSDHVTYTNSC 48
            |:.:.| ||:|.........||                   | |.|||.|.|:|.|:..||.|.|
Mosquito     8 PVVVVLFCLMAAASDENEAATRRWSLLPKRPSTPKWNLSAKP-CACPRTYKPLCASNGQTYNNHC 71

  Fly    49 ELKCAAQIKLIYVVKA-GRC 67
            ..|||.|:.....||| .||
Mosquito    72 AFKCAKQLNATLSVKAQARC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 19/40 (48%)
LOC4577980XP_001230687.2 None

Return to query results.
Submit another query.