DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and Kaz-m1

DIOPT Version :10

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_524507.1 Gene:Kaz-m1 / 43154 FlyBaseID:FBgn0002578 Length:156 Species:Drosophila melanogaster


Alignment Length:52 Identity:18/52 - (34%)
Similarity:23/52 - (44%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IALCLLAFVVL---TEAQVTRPLCP--CPRIYFPVCGSD---HVTYTNSCEL 50
            :.||.||.|..   .........||  ||.||.||||:|   ...:.::|.|
  Fly     6 LTLCCLALVACVYGNTVSTNDTACPTFCPSIYKPVCGTDGQNFKEFASTCNL 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 13/29 (45%)
Kaz-m1NP_524507.1 KAZAL 29..>67 CDD:197624 13/29 (45%)

Return to query results.
Submit another query.